PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV30476.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family G2-like
Protein Properties Length: 333aa    MW: 36083.7 Da    PI: 8.8617
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV30476.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.25.6e-31192247156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF +a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  KZV30476.1 192 KARRCWSPELHRRFEQALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 247
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.44189249IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-28190250IPR009057Homeodomain-like
SuperFamilySSF466891.55E-18190250IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-26192247IPR006447Myb domain, plants
PfamPF002491.2E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MSRLYPCFRG RAKQQLSGTT TEYNLRGQSE CSEQTSSPIF EEFIPLKRAS FHSDGEEEES  60
QNLKCGDGVQ SDKINGNEKN SKKSDWLRYV QLWNETPDPS SKEDSSRKVA VVEVNRNRGS  120
SDGAGGGGGA FHPFKKEKSL GIDGSTKNKT ESGDQPKSES VPPASTSSTA DTGGESGGAS  180
KKEEKGGESQ RKARRCWSPE LHRRFEQALQ QLGGSHAATP KQIRELMKVD GLTNDEVKSH  240
LQKYRLHMRR PGPTIQNNQH PQAPQFVVVG GIWVRPEYGA AAGDATAAVN GIYAPVASLP  300
QPFQGTISTH SPKQSEGGAQ QLHSPATSSS TFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077211.11e-123PREDICTED: uncharacterized protein LOC105161268
TrEMBLA0A068TX101e-108A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-61G2-like family protein